PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G77950.1
Common NameAGL67
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MIKC_MADS
Protein Properties Length: 252aa    MW: 29245.2 Da    PI: 5.5086
Description AGAMOUS-like 67
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G77950.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF74.11.2e-23958150
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                 krie ++nrq+tfskR++g++KKA+ELS+LCd++ a+++fs++++l  +s
  AT1G77950.1  9 KRIEKSTNRQITFSKRKKGLIKKAYELSTLCDIDLALLMFSPSDRLCLFS 58
                 79*****************************************9997765 PP

2K-box21.31.1e-08123195981
        K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelq 81 
                  +++++ e+l+qe+ +L+++++  ++e+R++  + +   s++e++  e +L + l+++ +++++ll+++ e + 
  AT1G77950.1 123 ATNSNVEELEQEVCRLQQQLQISEEELRKFEPDPMRLTSMEEIEACEANLINTLTRVVQRREHLLRKSCEAQS 195
                  67899*************************************************************9998764 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.0E-30160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006626.114161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.2E-26281IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-21323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.4E-221055IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-212338IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-213859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 252 aa     Download sequence    Send to blast
MGRVKLELKR IEKSTNRQIT FSKRKKGLIK KAYELSTLCD IDLALLMFSP SDRLCLFSGQ  60
TRIEDVLARY INLPDQEREN AIVFPDQSKR QGIQNKEYLL RTLEKLKIED DMALQINEPR  120
PEATNSNVEE LEQEVCRLQQ QLQISEEELR KFEPDPMRLT SMEEIEACEA NLINTLTRVV  180
QRREHLLRKS CEAQSNQQSM DGILLNDIVE DWGPEPEPKQ AHMIANSAHH SNQPSYDLLL  240
RRSNSSSNQN PK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S3e-17193193Myocyte-specific enhancer factor 2B
1tqe_R3e-17193193Myocyte-specific enhancer factor 2B
1tqe_Q3e-17193193Myocyte-specific enhancer factor 2B
1tqe_P3e-17193193Myocyte-specific enhancer factor 2B
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO793843280.0
Genevisible262185_at0.0
Expression AtlasAT1G77950-
AtGenExpressAT1G77950-
ATTED-IIAT1G77950-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G77950.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G77950
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0121280.0BT012128.1 Arabidopsis thaliana At1g77950 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001117616.10.0protein agamous-like 67
RefseqNP_177918.20.0protein agamous-like 67
SwissprotQ1PFC21e-108AGL66_ARATH; Agamous-like MADS-box protein AGL66
TrEMBLF4I8L60.0F4I8L6_ARATH; Protein agamous-like 67
STRINGAT1G77950.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21792365
Representative plantOGRP1617761
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. De Bodt S, et al.
    Genomewide structural annotation and evolutionary analysis of the type I MADS-box genes in plants.
    J. Mol. Evol., 2003. 56(5): p. 573-86
    [PMID:12698294]
  3. Parenicová L, et al.
    Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world.
    Plant Cell, 2003. 15(7): p. 1538-51
    [PMID:12837945]
  4. Kofuji R, et al.
    Evolution and divergence of the MADS-box gene family based on genome-wide expression analyses.
    Mol. Biol. Evol., 2003. 20(12): p. 1963-77
    [PMID:12949148]
  5. Scheible WR, et al.
    Genome-wide reprogramming of primary and secondary metabolism, protein synthesis, cellular growth processes, and the regulatory infrastructure of Arabidopsis in response to nitrogen.
    Plant Physiol., 2004. 136(1): p. 2483-99
    [PMID:15375205]
  6. de Folter S, et al.
    Comprehensive interaction map of the Arabidopsis MADS Box transcription factors.
    Plant Cell, 2005. 17(5): p. 1424-33
    [PMID:15805477]
  7. Cao D,Cheng H,Wu W,Soo HM,Peng J
    Gibberellin mobilizes distinct DELLA-dependent transcriptomes to regulate seed germination and floral development in Arabidopsis.
    Plant Physiol., 2006. 142(2): p. 509-25
    [PMID:16920880]
  8. Ito J, et al.
    Analysis of the Arabidopsis cytosolic proteome highlights subcellular partitioning of central plant metabolism.
    J. Proteome Res., 2011. 10(4): p. 1571-82
    [PMID:21166475]
  9. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]